Dharamshala में आज BJP की जनआक्रोश रैली,जमकर बरसें भाजपाई
Today on Monday, BJP’s public anger rally was organized in Dharamshala and in this the BJP lashed out at the failures of the state government during the last one year. BJP workers and common people from 15 assembly constituencies of Kangra district gathered at the police ground. After this, after gathering at the police ground, everyone reached the police ground to Kachari Chowk in a rally.
..#Janaakroshrally #Himachalpradesh #Congress #BJP
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
Dawood Ibrahim मारा गया? सोशल मीडिया पर लगाई जा रही जहर देने की अटकलें
अडंर वर्लड डॉन दाऊद इब्राहिम (Dawood Ibrahim) को पाकिस्तान में जहर देने की खबर सोशल मीडिया पर वायरल हो रही है। सोशल मीडिया पर ऐसी अटकलें लगाई जा रही हैं कि दाऊद को कराची में जहर दिया गया है। हालत गंभीर होने की वजह से वो कराची के एक अस्पताल में भर्ती है। अस्पताल के […]
हरियाणा के राम भक्त ने Ayodhya भेजी 40 टन बासमती चावल की खेप
हरियाणा के राम भक्त ने Ayodhya भेजी 40 टन बासमती चावल की खेप
As the date of consecration of life in Ayodhya is approaching, the curiosity among Ram devotees about seeing God is increasing… Preparations are going on in full swing in Ayodhya for the consecration of Ramlala. In such a situation, before the Pran Pratistha, all the Ram devotees are contributing for this grand event, in this sequence, a consignment of 40 tonnes of Basmati rice has reached Ayodhya for the food of Ram devotees coming for the Pran Pratistha of Ramlala.
#Ayodhya #Ramtemple #NarendraModi #NarendraModi #Ayodhya #RamTemplecase
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
‘मेरे सपनों की रानी’ गाने पर दादा ने किया Romantic Dance, वीडियो देख झूम उठा सोशल मीडिया
Older Man Romantic Dance: अगर आप उम्र को एक नंबर मानकर जिएंगे तो आपका दिल हमेशा जवान बना रहेगा। एक अंकल जी (Older Man Romantic Dance) ने अपने डांस के बदौलत सोशल मीडिया पर धूम मचा दी है। दादा जी ने डांस से सोशल मीडिया पर मचाया धमाल सोशल मीडिया पर एक एक वीडियो खूब […]
तीर्थयात्रियों को लेकर Telangana BJP अध्यक्ष G Kishan Reddy का बड़ा बयान, क्या कहा?
Union Minister and Telangana BJP President G. Kishan Reddy said, “For more than 22 years, I have been organizing Sri Ayyappa Swamy Padi Puja. Lakhs of people from both the Telugu states visit Sabarimala every year.
#UnionMinister #Telangana #BJPPresident #G.KishanReddy #SriAyyappaSwamyPadiPuja #Telugustates #Sabarimala
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
‘हिंदू सिर्फ झटका मीट खाएं,’ वाले बयान पर केंद्रीय मंत्री Giriraj Singh ने दी ये सफाई
‘हिंदू सिर्फ झटका मीट खाएं,’ वाले बयान पर केंद्रीय मंत्री Giriraj Singh ने दी ये सफाई
Union Minister Giriraj Singh has once again started the controversy of Halal and Jhatka. He talked about this while
#Girirajsingh #Hindu #Muslim #BJP
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
Ujjain के महाकालेश्वर मंदिर में BJP सांसद Ravi Kishan भस्म आरती हुए शामिल
Ujjain के महाकालेश्वर मंदिर में BJP सांसद Ravi Kishan भस्म आरती हुए शामिल
Priests offered prayers and performed ‘Bhasma Aarti’ at the Mahakaleshwar temple in Ujjain on December 18. BJP MP Ravi Kishan performed puja and also participated in Bhasma Aarti at Mahakaleshwar temple. A large number of devotees participated in the famous Bhasma Aarti of Mahakaleshwar temple.
#mahakaleshwartempleujjain #mahakaleshwartempleinujjain #mahakaleshwartemple #bjpmpravikishanoffersprayersatmahakaleshwartempleinujjainujjain#ravikishanatmahakaleshwartemple #livedarshanmahakaleshwartempleujjain #ujjainmahakaleshwartemple
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
राजौरी Headquarter में खुला PWD का नया Chief Engineer Office
Peoples of Pirpanjal Region was a Long Peniding Demands Now Have Been Fulfilled By Govt of J&k and Govt of india
Separate Chief Engineer of Pwd R&b Pirpanjal Region Office Opening at in Rajouri headquarter
#Jammukashmir #Rajouri #PWD #BJP
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
भारतीय नागरिकता मिलने में सीमा हैदर को आ रही अड़चन, AP Singh ने किया खुलासा
Six months have passed since Seema Haider came to India but she has not yet received Indian citizenship. Now her lawyer AP Singh has told why Seema Haider has not got Indian citizenship yet. She said that her first husband Ghulam Haider was creating obstacles in this.
#seemahaiderandsachinlovestory #seemahaiderlovestory #seemahaidersachinpubglovestory #pakistaniseemahaiderindiansachinlovestory #seemahaiderpakistan #seemahaidersachinpubglover #seemahaiderpakistannews
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com
Tamilnadu में बारिश ने मचाई तबाही, IMD ने जारी किया अलर्ट
The Meteorological Department issued a rain-related warning on Sunday. IMD said that there is a possibility of heavy rain in
many cities of Tamil Nadu for the next seven days.
#Tamilnadu #IMD #Tamilnadurains
Punjab Kesari Online is the online Branch of Punjab Kesari, Delhi, A Newspaper dedicated to fearless journalism . Punjab Kesari now brings you the same fearless journalism on You Tube covering topics from politics to social issues to economics to interviews with celebrities about issues concerning our nation and the world .
Please do not forget to Like, Comment, Share & Subscribe Punjab Kesari for such latest updates.
Follow us for Breaking News, Sports Coverage, Entertainment, Bollywood, Tech, Auto & more!
Click here to subscribe Punjab Kesari :- https://www.youtube.com/@PunjabKesariDotCom
Subscribe now to our network channels:
Shayari By Punjab Kesari – https://www.youtube.com/@ShayariByPunjabKesari
Cricket kesari – https://www.youtube.com/@CricketKesari
Bollywood Kesari – https://www.youtube.com/@BollywoodKesari
Punjab Kesari Delhi – https://www.youtube.com/@PunjabKesariDelhi
Follow Us On:
Facebook: https://www.facebook.com/punjabkesarinational
Twitter: https://www.twitter.com/punjabkesaricom
Instagram: https://www.instagram.com/punjabkesari_pk
For Bollywood News like us on: https://www.facebook.com/bollywoodkesari
Visit our website – https://www.punjabkesari.com